Mycobacterium burgundiense: MU0053_002701 Help Entry MU0053_002701     CDS       T10823                                  Name (GenBank) ferredoxin   KO K24530   ferredoxin Organism mbug  Mycobacterium burgundiense Pathway mbug01100   Metabolic pathways mbug01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbug00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    00522 Biosynthesis of 12-, 14- and 16-membered macrolides     MU0053_002701  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mbug01008]     MU0053_002701 Polyketide biosynthesis proteins [BR:mbug01008]  Nonribosomal peptide tailoring proteins   Others    MU0053_002701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_15 Fer4_13 Fer4_19 Fer4_7 Fer4 Fer4_6 Fer4_8 Fer4_2 Motif Other DBs NCBI-ProteinID:  CAJ1504504 LinkDB All DBs Position 1:2917506..2917700 Genome browser AA seq 64 aa AA seqDB search MADVAVDLDKCIGTGMCEASAPNVFQVGDDGQAQVRTAKVAPEDLDAAKEAVANCPTGAL TLHD NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggcggacgtcgcagtcgatctggacaaatgcatcggcaccgggatgtgtgaggccagc gcacccaacgtattccaagtcggggacgacgggcaggcccaggttcgcacggcgaaggtg gcccccgaagacctcgacgcggcgaaggaagccgtcgccaactgtccgacaggtgcgttg acgcttcacgactga

DBGET integrated database retrieval system