Methylotuvimicrobium buryatense: EQU24_02010 Help Entry EQU24_02010       CDS       T05995                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mbur  Methylotuvimicrobium buryatense Pathway mbur01100   Metabolic pathways mbur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EQU24_02010    00074 Mycolic acid biosynthesis     EQU24_02010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EQU24_02010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QCW81161 UniProt:  A0A4P9ULY3 LinkDB All DBs Position complement(423944..424207) Genome browser AA seq 87 aa AA seqDB search MSSLENELKKLIIESLDLEDIGVDDIDSHEALFNEGLGLDSIDALELGLAIRKKYNIRID SEKDDVVNIFASVAALAEFIDSEQRAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcagtttggaaaatgaattaaaaaaattgattatcgagtcgctcgatttggaggat atcggcgttgacgatatcgatagtcacgaagccctgtttaacgaaggcttagggctggac tcgatcgacgctttggaactgggactcgcgatccgaaagaaatacaatatccggatcgat tcggaaaaagacgacgtggtaaatattttcgcctcagttgccgcgctggctgaattcatt gattccgagcagagggcagcatga

DBGET integrated database retrieval system