Methanosarcina barkeri MS: MSBRM_2672 Help Entry MSBRM_2672        CDS       T03838                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mby  Methanosarcina barkeri MS Pathway mby03010   Ribosome Brite KEGG Orthology (KO) [BR:mby00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSBRM_2672   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSBRM_2672  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mby03011]     MSBRM_2672    04121 Ubiquitin system [BR:mby04121]     MSBRM_2672   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mby04147]     MSBRM_2672 Ribosome [BR:mby03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSBRM_2672   Archaea     MSBRM_2672 Ubiquitin system [BR:mby04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSBRM_2672 Exosome [BR:mby04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSBRM_2672   Exosomal proteins of colorectal cancer cells    MSBRM_2672 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_Ribbon_TF Zn_ribbon_RPB9 Zn_Ribbon_1 DUF6671 Cas12f1-like_TNB DUF1451 Zn_ribbon_NUD Zn_ribbon_NOB1 Zn_ribbon_13 Zn_ribbon_IS1595 Baculo_ME53 Motif Other DBs NCBI-ProteinID:  AKB55670 UniProt:  A0A0E3QW29 LinkDB All DBs Position 3509106..3509255 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRIKQFCPRCGPGTFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactataaagtccagggcgactccgtaacaagaatcaaacagttc tgtcccagatgcggaccaggtacgttcctagccgatcacaagaaccgcctcgcctgcggg aagtgcggctataccgaattcaagaagtaa

DBGET integrated database retrieval system