Methylococcus capsulatus: MCA0706 Help Entry MCA0706           CDS       T00205                                  Symbol groES-1 Name (GenBank) chaperonin, 10 kDa subunit   KO K04078   chaperonin GroES Organism mca  Methylococcus capsulatus Brite KEGG Orthology (KO) [BR:mca00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mca03110]     MCA0706 (groES-1)    03029 Mitochondrial biogenesis [BR:mca03029]     MCA0706 (groES-1) Chaperones and folding catalysts [BR:mca03110]  Heat shock proteins   HSP10    MCA0706 (groES-1) Mitochondrial biogenesis [BR:mca03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MCA0706 (groES-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 RodZ_C Motif Other DBs NCBI-ProteinID:  AAU93156 UniProt:  Q60AY1 LinkDB All DBs Position 743738..744028 Genome browser AA seq 96 aa AA seqDB search MKIRPLHDRVIIKRLEEERTSAGGIVIPDSAAEKPMRGEILAVGNGKVLDNGEVRALQVK VGDKVLFGKYAGTEVKVDGEDVVVMREDDILAVLES NT seq 291 nt NT seq  +upstreamnt  +downstreamnt gtgaaaattcgtcctttgcacgaccgagtcatcatcaaacgtctggaagaggaacgcacc agcgcaggcggaatcgtgattcccgacagcgcggcggaaaagcccatgcgcggcgagatc ctggccgttggcaacggcaaggtgctcgacaacggtgaggtgcgcgcgctgcaggtcaag gtgggcgacaaggtcctgttcggcaagtatgccggtaccgaggtcaaggtcgatggcgaa gacgtggtggtgatgcgggaggacgacatcctggccgtcctcgagagctga

DBGET integrated database retrieval system