Methylococcus capsulatus: MCA1107 Help Entry MCA1107           CDS       T00205                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism mca  Methylococcus capsulatus Pathway mca00190   Oxidative phosphorylation mca01100   Metabolic pathways mca02020   Two-component system Module mca_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:mca00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     MCA1107 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     MCA1107 (ybgT) Enzymes [BR:mca01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      MCA1107 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AAU92604 UniProt:  Q609X0 LinkDB All DBs Position 1163628..1163750 Genome browser AA seq 40 aa AA seqDB search MWYFAWILGVGFACAFGVINAMWLESVCDIDDPAAGGAEN NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcgtggatactcggggtgggtttcgcatgtgcattcggtgtcatcaat gccatgtggttggaatcggtctgtgacatcgacgacccggcggcgggcggtgcggaaaat tga

DBGET integrated database retrieval system