Macrococcoides canis: MCCS_10550 Help Entry MCCS_10550        CDS       T04838                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mcak  Macrococcoides canis Pathway mcak00998   Biosynthesis of various antibiotics mcak01100   Metabolic pathways mcak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MCCS_10550 (acpP)    00074 Mycolic acid biosynthesis     MCCS_10550 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MCCS_10550 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARQ06702 UniProt:  A0A1W7AAP9 LinkDB All DBs Position 1005210..1005443 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTADASFKDDLGADSLDIAELVMELEDQFGTEIPDEDAE KINTVGDAVKYIESLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaaaacttcgacaaagtaaaagatattatcgtagatcgtcttggtgtagatgcagat aaagtaactgcagatgcttcattcaaagatgatttaggtgcggattctttagatatcgct gaattagtaatggaattagaagatcagttcggtactgagattcctgatgaagatgctgaa aaaatcaacacggttggtgatgcagtgaaatatattgaatcattagaaaaataa

DBGET integrated database retrieval system