KEGG   Moraxella catarrhalis 25239: MC25239_00696
Entry
MC25239_00696     CDS       T03381                                 
Symbol
nuoM
Name
(GenBank) NADH-quinone oxidoreductase subunit M
  KO
K00342  NADH-quinone oxidoreductase subunit M [EC:7.1.1.2]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00190  Oxidative phosphorylation
mcat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC25239_00696 (nuoM)
Enzymes [BR:mcat01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     MC25239_00696 (nuoM)
SSDB
Motif
Pfam: Proton_antipo_M
Other DBs
NCBI-ProteinID: AIT43123
LinkDB
Position
774356..776083
AA seq 575 aa
MALEQNWILPALIAIPLIAGFLCWLIEKISDRLPRWIALISMVITFILTLVLWKQGNFNT
LLVTDTAVSGETLPWAAQFILPWIPSFGIKFHLAMDGLSLLMIALTAFLGIMAVGCSWGE
IQRRVGFFHLNLLWSLGGVIGVFLAIDLFLFFFFWELMLLPIYFLIALWGHNATGGKSKE
YAATKFFIYTQASGLIMLIGILLLVIIQFSQTGVLSFDYHDLLGVNLGDWEYAIMLCFFI
GFAVKLPIFPLHGWLPDAHAQAPTAGSVDLAGILIKTAAFGLLRFVIPLFPNASAQFAPV
AITLGMIGVFYGAFLAFAQTDIKRLLAYTSVSHMGFVVLAIYAGTLVSLQGLMVQMLAHG
LSSAALFIMAGQIYERLHTRDMTVMGGMWGQFRRLAPFMMFFCAALLGIPGTGNFIGEIL
ILIGAFAIHPIFVTLATVSLVMAGLYSLMIIYHALFGQNTTLELVKQNHGTLKDLGKREL
VLLLSLAIGLVWLGLYPQPVMDKSEGSMQWIASAYAHDVIMADEPMHGIRLIEGNMGDYM
HAHHHQLHGQGYDAGIHHHKGSDGHHHDHQTKQGE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggcattagaacaaaattggatactaccagcattgatcgcaattccgttgattgcaggc
tttttatgctggttaattgaaaaaatcagcgatcgcctgccacgctggattgcactgatt
agcatggtcattacttttattttgaccttagtgctttggaaacaagggaattttaatacg
ctactggtaacagatacagcggtcagcggtgagacattgccttgggcggcacagtttatc
ctgccatggattccaagttttggcattaaatttcatttagcgatggatggcttgtcttta
ctgatgattgcgttgacggcatttttgggtattatggcggtgggctgctcatggggcgaa
attcagcgccgtgtgggattttttcatcttaatctgctgtggtcactaggcggcgtgatc
ggcgtatttttagccattgatttgtttttgtttttctttttttgggaattgatgctgttg
ccgatttattttttgattgcactttggggacataatgccacagggggtaagagcaaagaa
tacgcagcaaccaagttctttatttatacacaagcctcaggcttgatcatgttaattggc
attttattattagtcattattcagtttagccaaacaggtgttttaagttttgattatcat
gatctcttaggggtaaatcttggtgattgggaatatgccatcatgctttgcttttttatt
ggttttgcagttaagctgccaatatttcccttgcatggttggctgcctgatgcccacgcc
caagcaccaacggcaggttcggtagatttggcggggattttgattaagacggcggcattt
ggcttgttgcgttttgtcattccattatttccaaatgcctcggcacaatttgccccagtg
gcgataactttgggcatgattggcgtattttatggggcatttttggcatttgcccaaacc
gatatcaagcgactgctcgcttataccagtgtgtcgcatatgggttttgtcgtgcttgcc
atttatgctggcacacttgtatcgttacaaggtttgatggtgcaaatgctcgctcatggt
ctatcaagtgcagcactgtttattatggcaggtcaaatttatgagcgtttgcacactcgt
gatatgacggtaatgggtggcatgtggggacagtttcgccgccttgctccatttatgatg
ttcttttgtgcggcattgttgggcatacctggtacgggtaactttattggtgagattttg
attttgattggtgcttttgccatacatccgatctttgtcacacttgccacagtaagcctt
gtgatggcaggactgtattctttgatgataatttatcatgcgttatttggtcaaaatacc
acgcttgaattggtgaagcaaaatcacggtacgctaaaagatttgggtaaacgagaattg
gtattgctactttctttggcaatcggtttggtatggcttggcttgtaccctcagcctgtt
atggataagtctgaagggtcaatgcagtggattgccagtgcttatgcacatgatgtcatc
atggcagatgagccaatgcatggcattcgattgattgaagggaatatgggtgactatatg
catgcccatcaccatcagctgcatggtcaaggatatgacgctggtatacatcatcacaaa
ggctctgatggccatcatcacgatcaccaaaccaagcagggggaataa

DBGET integrated database retrieval system