Methylomarinovum caldicuralii: MIT9_P0092
Help
Entry
MIT9_P0092 CDS
T09494
Name
(GenBank) large subunit ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
mcau
Methylomarinovum caldicuralii
Pathway
mcau03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
mcau00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
MIT9_P0092
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
mcau03011
]
MIT9_P0092
Ribosome [BR:
mcau03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
MIT9_P0092
Bacteria
MIT9_P0092
Archaea
MIT9_P0092
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DUF1069
DUF7712
PTEN2_C2
Motif
Other DBs
NCBI-ProteinID:
BCX80519
UniProt:
A0AAU9C3Z9
LinkDB
All DBs
Position
complement(85121..85474)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKASRMRRAAKARARIRRLGIHRLTVHRTPKHIYAQITTADGSKVLAAAATVQADIRS
QVKSPGNIEAAKLVGAAIAAKAKEAGIEEVAFDRSGFKYHGRVKALADAAREGGLRF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggacaagaaagcatcgcgtatgcgccgtgcggccaaggcacgcgcgcggatccggcgg
ttgggcatccaccgtctgacggtgcaccggacaccgaagcacatctacgcccagatcacc
acggcggatggctcgaaagtcttggcagcggcggcgacggtccaggccgatattcgcagc
caggtgaaaagccccggcaatatcgaggcggccaagctggtgggggcggcgatcgccgcc
aaggccaaagaggcaggtatcgaggaagtggctttcgaccgttccggtttcaagtatcac
ggccgggtgaaggcgttggcggatgcagcccgcgaaggcggattacgattctag
DBGET
integrated database retrieval system