Methylomarinovum caldicuralii: MIT9_P1862 Help Entry MIT9_P1862        CDS       T09494                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mcau  Methylomarinovum caldicuralii Pathway mcau01100   Metabolic pathways mcau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MIT9_P1862    00074 Mycolic acid biosynthesis     MIT9_P1862   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MIT9_P1862 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BCX82276 UniProt:  A0AAU9CKS1 LinkDB All DBs Position complement(1905400..1905636) Genome browser AA seq 78 aa AA seqDB search MSDVAERVKKIVAEQLGVKEEISNDASFVDDLGADSLDTVELVMALEEEFDCEIPDEEAE KITTVQEAIDYIEKHLNQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtggcagaacgtgtgaagaagatcgtggcggaacagctgggcgtgaaggaa gaaatctccaacgacgcctcctttgtcgacgatctgggggccgattccctcgataccgta gagctggtgatggcgctggaggaggagttcgactgcgaaatccccgacgaggaagccgaa aagatcaccacggttcaggaagccatcgactacatcgaaaagcatctgaatcagtga

DBGET integrated database retrieval system