Micromonospora cathayae: PVK37_20435
Help
Entry
PVK37_20435 CDS
T10286
Name
(GenBank) M56 family metallopeptidase
KO
K02172
bla regulator protein blaR1
Organism
mcay Micromonospora cathayae
Pathway
mcay01501
beta-Lactam resistance
Module
mcay_M00627
beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:
mcay00001
]
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
PVK37_20435
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
mcay01002
]
PVK37_20435
09183 Protein families: signaling and cellular processes
01504 Antimicrobial resistance genes [BR:
mcay01504
]
PVK37_20435
Peptidases and inhibitors [BR:
mcay01002
]
Metallo peptidases
Family M56
PVK37_20435
Antimicrobial resistance genes [BR:
mcay01504
]
Gene sets
beta-Lactam resistance modules
beta-Lactam resistance, Bla system [MD:
M00627
]
PVK37_20435
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_M48
Peptidase_M56
SprT-like
MotA_ExbB
Motif
Other DBs
NCBI-ProteinID:
WDZ82834
UniProt:
A0ABY7ZIM1
LinkDB
All DBs
Position
complement(4508101..4508994)
Genome browser
AA seq
297 aa
AA seq
DB search
MWPLLLTIVATGCAFRATAGAPPGTWTYRMPCAVLGLWVGAVLMVPVSAVAALLILAADR
HTPETTQLWSTVPTVGVSAALLVLSGRIAVRFRRLNRAARQRRRRHEMLIDLFAVRHPEL
PGVDVVPDARLFAYSVPCVVSGRIVLSQGTLDQLDPEPLRAVLAHERAHLVARHHLVLQL
ATALAQMFPRLGTGGTATGRIPTLIEMAADCRARRRIGRQHTIDALTVLAGTPVPDGMLA
AGHHAVALRLAVLRRPADCCQAGRAAGVYAAAVAMLALAPTVALLNQIVDLCLPGVA
NT seq
894 nt
NT seq
+upstream
nt +downstream
nt
atgtggccgttgctgctcaccatcgtcgcgaccggctgcgcgttccgggccacggccggc
gcgccaccgggcacctggacgtaccggatgccgtgcgccgtgctgggcctctgggtcggc
gcggtcctcatggtgccggtcagcgcggtggccgcgctgctgatcctggcggcggaccgg
cacaccccggagacgacccagctgtggtccaccgtcccgacggtcggggtgagcgccgca
ctgctggtgctgtccgggcggatagcggtccggttccgccggctcaaccgggccgcccgg
cagcggcggcggcgacacgagatgctgatcgacctgttcgcggtacgccatccggagctg
cccggggtcgacgtcgtgccggacgcccggctgttcgcctacagcgtgccgtgtgtggtg
tccggccggatcgtgctctcccaggggactctcgaccagctcgaccccgagccgctgcgt
gcggtgctggcccacgaacgcgcgcacctcgtcgcccggcaccacctggtgctgcaactg
gccaccgcgctggcccagatgttcccccggctgggcaccggcgggacggccaccggccgg
atcccgaccctgatcgagatggccgccgactgccgggcccggcggcggatcggccgccag
cacaccatcgacgcgctgaccgtgctggccggcaccccggtcccggacgggatgctggcg
gccgggcaccacgccgtggcgctgcggctggcggtgctgcggcggccggccgactgctgc
caggccggccgggcggccggggtgtacgccgccgccgtggcgatgctggcgctggccccg
acggtcgccctgctcaaccagatcgtcgacctctgcctgccgggtgtcgcgtga
DBGET
integrated database retrieval system