Micromonospora cathayae: PVK37_24370 Help Entry PVK37_24370       CDS       T10286                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism mcay  Micromonospora cathayae Pathway mcay00253   Tetracycline biosynthesis mcay01056   Biosynthesis of type II polyketide backbone mcay01100   Metabolic pathways mcay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcay00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     PVK37_24370    00253 Tetracycline biosynthesis     PVK37_24370  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:mcay01004]     PVK37_24370    01008 Polyketide biosynthesis proteins [BR:mcay01008]     PVK37_24370 Lipid biosynthesis proteins [BR:mcay01004]  Polyketide synthase   Component type    PVK37_24370 Polyketide biosynthesis proteins [BR:mcay01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      PVK37_24370     Nonaketide PKS      PVK37_24370     Decaketide PKS      PVK37_24370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WDZ83572 LinkDB All DBs Position complement(5512471..5512725) Genome browser AA seq 84 aa AA seqDB search MTGITLDTLRDILVEAAGADESTGLDGDILDTPFRDLGYDSLALIETAARLRRRYGVEIP DEQVTELDTPRKLLDFVDAAVAAR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccggcatcaccctggacacgctgcgcgacatcctcgtcgaagccgcgggcgcggac gagtccaccggactcgacggcgacatcctggacaccccgttccgggacctcggctacgac tcgctcgccctgatcgagaccgccgcccggctccgccgccggtacggggtggagatcccg gacgagcaggtgaccgagctggacaccccgaggaagctgctcgacttcgtcgacgccgcc gtggcggcgcgctga

DBGET integrated database retrieval system