Macaca mulatta (rhesus monkey): 100423251 Help Entry 100423251         CDS       T01028                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04140   Autophagy - animal mcc04144   Endocytosis mcc04152   AMPK signaling pathway mcc04530   Tight junction mcc04972   Pancreatic secretion mcc05014   Amyotrophic lateral sclerosis mcc05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100423251 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100423251 (RAB8A)    04140 Autophagy - animal     100423251 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     100423251 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     100423251 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100423251 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     100423251 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     100423251 (RAB8A)    03036 Chromosome and associated proteins [BR:mcc03036]     100423251 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     100423251 (RAB8A)    04031 GTP-binding proteins [BR:mcc04031]     100423251 (RAB8A) Membrane trafficking [BR:mcc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     100423251 (RAB8A)  Autophagy   Other autophagy associated proteins     100423251 (RAB8A) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100423251 (RAB8A) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100423251 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    100423251 (RAB8A)   Exosomal proteins of colorectal cancer cells    100423251 (RAB8A) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     100423251 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  100423251 NCBI-ProteinID:  XP_014978695 Ensembl:  ENSMMUG00000015784 UniProt:  F7AVY7 A0A8J8YDV4 LinkDB All DBs Position 19:15605393..15628141 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag atatgggacacggctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtgtacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcgcaacattgaggagcatgcctctgcagacgtcgaaaagatgatactcggg aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaacgtggaaaat gcatttttcactctggccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system