Macaca mulatta (rhesus monkey): 100425223 Help Entry 100425223         CDS       T01028                                  Symbol CYCS Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc00190   Oxidative phosphorylation mcc01100   Metabolic pathways mcc01524   Platinum drug resistance mcc04115   p53 signaling pathway mcc04210   Apoptosis mcc04215   Apoptosis - multiple species mcc04932   Non-alcoholic fatty liver disease mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05017   Spinocerebellar ataxia mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05132   Salmonella infection mcc05134   Legionellosis mcc05145   Toxoplasmosis mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05210   Colorectal cancer mcc05222   Small cell lung cancer mcc05416   Viral myocarditis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100425223 (CYCS)  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100425223 (CYCS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100425223 (CYCS)   09162 Cancer: specific types    05210 Colorectal cancer     100425223 (CYCS)    05222 Small cell lung cancer     100425223 (CYCS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100425223 (CYCS)    05161 Hepatitis B     100425223 (CYCS)    05160 Hepatitis C     100425223 (CYCS)    05164 Influenza A     100425223 (CYCS)    05162 Measles     100425223 (CYCS)    05163 Human cytomegalovirus infection     100425223 (CYCS)    05167 Kaposi sarcoma-associated herpesvirus infection     100425223 (CYCS)    05169 Epstein-Barr virus infection     100425223 (CYCS)   09171 Infectious disease: bacterial    05134 Legionellosis     100425223 (CYCS)    05152 Tuberculosis     100425223 (CYCS)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100425223 (CYCS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100425223 (CYCS)    05012 Parkinson disease     100425223 (CYCS)    05014 Amyotrophic lateral sclerosis     100425223 (CYCS)    05016 Huntington disease     100425223 (CYCS)    05017 Spinocerebellar ataxia     100425223 (CYCS)    05020 Prion disease     100425223 (CYCS)    05022 Pathways of neurodegeneration - multiple diseases     100425223 (CYCS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100425223 (CYCS)    05416 Viral myocarditis     100425223 (CYCS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100425223 (CYCS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100425223 (CYCS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100425223 NCBI-ProteinID:  XP_028701781 LinkDB All DBs Position 3:90025188..90027719 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system