KEGG   Macaca mulatta (rhesus monkey): 100425793
Entry
100425793         CDS       T01028                                 
Symbol
TP53AIP1
Name
(RefSeq) LOW QUALITY PROTEIN: p53-regulated apoptosis-inducing protein 1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100425793 (TP53AIP1)
   04115 p53 signaling pathway
    100425793 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 100425793
NCBI-ProteinID: XP_028689993
LinkDB
Position
14:complement(121661934..121665267)
AA seq 123 aa
MGSSSKASFRSAQASGSGARRQGLGRGDQSLSMMPPNGRAQTHTLDWGSPCTLCLQVHGR
CRGREAPSVSSGSWSSATVWCLTDLGLGLSRPFFPGATVLKDRPLGSAVSLSCDQKKAPL
RLQ
NT seq 372 nt   +upstreamnt  +downstreamnt
atggggtcttcctctaaggcgagcttcagatctgctcaagcttccggcagtggggccagg
aggcagggcctgggcaggggagaccagagcctctcgatgatgcctcccaacggcagggct
cagacacacacactggactggggaagcccctgcactttgtgtctccaagttcacggaagg
tgcaggggaagagaagctccatcagtttcgtctggatcttggtcctcagcaactgtctgg
tgcctgacagaccttggtctaggtctctccaggcctttctttcctggagccacagtgctt
aaagataggccactggggtcagcagtaagcctgagctgtgatcagaaaaaagcaccattg
aggttgcagtga

DBGET integrated database retrieval system