Macaca mulatta (rhesus monkey): 100426537 Help Entry 100426537         CDS       T01028                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04620   Toll-like receptor signaling pathway mcc05142   Chagas disease mcc05163   Human cytomegalovirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100426537    04061 Viral protein interaction with cytokine and cytokine receptor     100426537  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100426537    04062 Chemokine signaling pathway     100426537  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100426537   09174 Infectious disease: parasitic    05142 Chagas disease     100426537   09163 Immune disease    05323 Rheumatoid arthritis     100426537   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100426537  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     100426537    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     100426537 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    100426537 Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Chemokines    100426537 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100426537 NCBI-ProteinID:  XP_002800712 LinkDB All DBs Position 16:32818079..32820299 Genome browser AA seq 92 aa AA seqDB search MQVSTAALAVLLCTVVLCNRISATFGADTPTSCCFSYISRQIPQNFIADYFETSSQCSKP GVIFLTKRGRQVCADPSKDWVQKYVSDVELSA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctccactgctgcccttgctgtcctcctctgcaccgtggttctctgcaaccgg atctcagcaacatttggtgctgacacgccgacctcctgctgcttcagctacatctcccga cagattccacagaatttcatagctgactactttgagaccagcagccagtgctccaagccc ggtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtaaggactgg gtccagaaatacgtcagcgacgtggagctgagtgcctga

DBGET integrated database retrieval system