Macaca mulatta (rhesus monkey): 106997851 Help Entry 106997851         CDS       T01028                                  Name (RefSeq) histone H2B type 1-A-like   KO K11252   histone H2B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106997851  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106997851   09163 Immune disease    05322 Systemic lupus erythematosus     106997851   09165 Substance dependence    05034 Alcoholism     106997851  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     106997851   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     106997851 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106997851 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106997851 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID Motif Other DBs NCBI-GeneID:  106997851 NCBI-ProteinID:  XP_014991195 Ensembl:  ENSMMUG00000046618 LinkDB All DBs Position 4:144260306..144262218 Genome browser AA seq 129 aa AA seqDB search MNMLQLASKGTTTSKKGFKKAVAKTQKKEGKKRKRCCKESYFIYIYKVLKQVHPDTAISS KAMSMMNSFVSDIFEHIAGEASLLAHYDKHSTITSREIQTAMRLLLPGELAKHAVLEGTK AVTKYTSSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgaacatgctgcagcttgcttcaaagggcactacaacttccaaaaagggcttcaagaag gcagtcgctaaaactcaaaagaaggagggtaaaaagcgcaagagatgctgcaaagagagc tattttatttacatttacaaggtgctgaagcaggtccacccggacactgcaatctcttcc aaggccatgagtatgatgaattcttttgttagtgacatttttgagcacattgcaggtgag gcttccctcctggcgcattatgacaagcactcgaccatcacctccagggagatccagacg gccatgcgcttgctgctgcccggggaactagccaagcatgctgtgttggagggcaccaag gctgtcaccaagtacaccagctccaagtaa

DBGET integrated database retrieval system