Macaca mulatta (rhesus monkey): 107000817 Help Entry 107000817         CDS       T01028                                  Name (RefSeq) histone H2B type 2-F isoform X2   KO K11252   histone H2B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107000817  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107000817   09163 Immune disease    05322 Systemic lupus erythematosus     107000817   09165 Substance dependence    05034 Alcoholism     107000817  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     107000817   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     107000817 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107000817 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107000817 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  107000817 NCBI-ProteinID:  XP_015006900 LinkDB All DBs Position 1:101350030..101363330 Genome browser AA seq 128 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSNIF NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctcccaagaagggctccaaaaaggctgttacg aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtt tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcaggagaagcgtcccgc ctggcgcactacaacaagcgctccaccatcacgtcccgcgagatccagacggccgtgcgc ctgctgctgcctggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctcgaacattttctag

DBGET integrated database retrieval system