Macaca mulatta (rhesus monkey): 114672195 Help Entry 114672195         CDS       T01028                                  Symbol SCT Name (RefSeq) secretin   KO K05263   secretin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04080   Neuroactive ligand-receptor interaction mcc04972   Pancreatic secretion mcc04976   Bile secretion Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     114672195 (SCT)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     114672195 (SCT)    04976 Bile secretion     114672195 (SCT)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     114672195 (SCT) Cytokines and neuropeptides [BR:mcc04052]  Neuropeptides   GPCR binding    114672195 (SCT) SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  114672195 NCBI-ProteinID:  XP_028688807 LinkDB All DBs Position 14:complement(683603..684119) Genome browser AA seq 89 aa AA seqDB search MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ DAENSTAWSRLGAGLLCPSGSDTPTLQAW NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccccccggcccctcctgctgctgctgctgctcctcgggggctccgccgcgcgcccc gcgccccccagggcccggcgacactcggacgggacgttcaccagcgagctcagccgcctg cgggagggcgcgcggctccagcggctgctgcagggcctggtggggaagcgcagcgagcag gacgcagagaacagcacggcctggtccaggctcggcgcgggtctgctctgcccgtccggg tccgacacgcccaccctgcaggcctggtga

DBGET integrated database retrieval system