Macaca mulatta (rhesus monkey): 114677623 Help Entry 114677623         CDS       T01028                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05202   Transcriptional misregulation in cancer mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114677623  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     114677623   09163 Immune disease    05322 Systemic lupus erythematosus     114677623   09165 Substance dependence    05034 Alcoholism     114677623  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     114677623   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     114677623 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114677623 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114677623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C PAF Motif Other DBs NCBI-GeneID:  114677623 NCBI-ProteinID:  XP_028703491 LinkDB All DBs Position 4:134688127..134689560 Genome browser AA seq 136 aa AA seqDB search MAPTKQTARKSTGGKAPRKQPATKATRKSAPSTGGVKKPHGYRPGTVGLREIRRYQKSTE LLIRKLPFQRLVREIVQDFKTDLRFQSTAIGALQEASEAYLVGLFEDTNLCAIHAKHVTI MPKDIQLAHCIHGERV NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ccggctacaaaagccactcgcaagagtgcgccctctactggaggggtgaagaaacctcat ggttacaggcctggtactgtggggctccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgttcaggactttaaa acagatctgcgcttccagagcacagctatcggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacatgtaacaatt atgccaaaagacatccagctagcacactgcatacatggagaacgtgtttaa

DBGET integrated database retrieval system