Macaca mulatta (rhesus monkey): 2846621 Help Entry 2846621           CDS       T01028                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc00190   Oxidative phosphorylation mcc01100   Metabolic pathways mcc04714   Thermogenesis mcc04723   Retrograde endocannabinoid signaling mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05208   Chemical carcinogenesis - reactive oxygen species mcc05415   Diabetic cardiomyopathy Module mcc_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mcc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     2846621 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     2846621 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     2846621 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     2846621 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     2846621 (ND4L)    05012 Parkinson disease     2846621 (ND4L)    05014 Amyotrophic lateral sclerosis     2846621 (ND4L)    05016 Huntington disease     2846621 (ND4L)    05020 Prion disease     2846621 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     2846621 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     2846621 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mcc03029]     2846621 (ND4L) Enzymes [BR:mcc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      2846621 (ND4L) Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     2846621 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  2846621 NCBI-ProteinID:  YP_026112 UniProt:  Q6IYH0 I3W8K6 LinkDB All DBs Position MT:10461..10757 Genome browser AA seq 98 aa AA seqDB search MTLTYMNIMLAFAISLLGMLTYRSHLVASLLCLEGMMMSLFIMATLIASNTHFPLINIMP IILLVFAACETAVGLALLISISNTYGLDYVHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacccttacctatataaacattatactagcattcgctatctctcttctaggtatacta acctaccgctcacacctagtagcctctctcctctgcctagagggaataataatatcgctc tttattatggccacccttattgcctcaaacacacacttccccctaatcaacattataccc atcattttgttagtatttgccgcctgtgaaacagcagtaggtcttgccctactaatctca atctccaacacatacggactagactacgtccacaacctaaacctgcttcaatgctaa

DBGET integrated database retrieval system