Macaca mulatta (rhesus monkey): 2846632 Help Entry 2846632           CDS       T01028                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc00190   Oxidative phosphorylation mcc01100   Metabolic pathways mcc04714   Thermogenesis mcc04723   Retrograde endocannabinoid signaling mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05208   Chemical carcinogenesis - reactive oxygen species mcc05415   Diabetic cardiomyopathy Module mcc_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mcc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     2846632 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     2846632 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     2846632 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     2846632 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     2846632 (ND6)    05012 Parkinson disease     2846632 (ND6)    05014 Amyotrophic lateral sclerosis     2846632 (ND6)    05016 Huntington disease     2846632 (ND6)    05020 Prion disease     2846632 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     2846632 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     2846632 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mcc03029]     2846632 (ND6) Enzymes [BR:mcc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      2846632 (ND6) Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     2846632 (ND6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 DUF3165 Motif Other DBs NCBI-GeneID:  2846632 NCBI-ProteinID:  YP_026115 UniProt:  Q6IYG7 LinkDB All DBs Position MT:complement(14140..14667) Genome browser AA seq 175 aa AA seqDB search MTYILFALSVLLVMGFVGFSSKPSPIYGGLALIVSGVIGCVIVLSCGGAYMGLMMFLVYL GGMMVVFGYTTAMAIEEYPETWGSGFEVLGGLLVGLMMEVMLVLWVLSLDEAVEVVVSFS DTGDWVIFEGEGSGLIRGDSIGAGALYDYGRWLVVVAGWTLFVGVYVVIEIVRGN NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgacgtatattttgtttgcattgagtgttttattagttatggggtttgtggggttttct tctaagccttctcctatttatgggggtctggcgttaattgttagtggtgtgattggttgt gtgattgttttaagttgtgggggggcttatatgggtttgatgatgtttttagtttatctg gggggtatgatggttgtttttggttatactactgcaatggctattgaagagtatcctgag acatggggttcggggtttgaggttttagggggtcttttagtagggttgataatggaggtg atattagttttatgggttttaagtttggatgaggcggtagaagtggtggttagttttagt gatactggtgattgggtgatttttgagggggaggggtcaggattgattcgaggtgattct attggtgcgggtgccttatatgattatgggcgttgattagtggtagttgctggttggaca ttatttgttggtgtgtatgttgtgattgagattgttcggggtaatagg

DBGET integrated database retrieval system