Macaca mulatta (rhesus monkey): 574114 Help Entry 574114            CDS       T01028                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y precursor   KO K05232   neuropeptide Y Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04024   cAMP signaling pathway mcc04080   Neuroactive ligand-receptor interaction mcc04920   Adipocytokine signaling pathway mcc04923   Regulation of lipolysis in adipocytes mcc05034   Alcoholism Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     574114 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     574114 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     574114 (NPY)    04920 Adipocytokine signaling pathway     574114 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     574114 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574114 (NPY) Cytokines and neuropeptides [BR:mcc04052]  Neuropeptides   GPCR binding    574114 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  574114 NCBI-ProteinID:  NP_001027986 Ensembl:  ENSMMUG00000009818 UniProt:  Q9XSW6 A0A8J8YAR8 G7MLN4 Structure PDBPDBj LinkDB All DBs Position 3:complement(90845859..90853344) Genome browser AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctaggtagcaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg tgcctgggtgcgctggccgaggcgtacccttccaaaccggacaacccgggcgaggacgcg ccagcggaggacatggccagatactactcggcgctgcgacactacatcaacctcatcacc aggcagaggtatggcaaacgatctagcccagagacactgatttcagacctcttgatgaga gaaagcacagaaaatgttcccagaactcggcttgaagacccttcaatgtggtga

DBGET integrated database retrieval system