Macaca mulatta (rhesus monkey): 574217 Help Entry 574217            CDS       T01028                                  Symbol CCL4L1 Name (RefSeq) C-C motif chemokine 4 precursor   KO K12964   C-C motif chemokine 4 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04064   NF-kappa B signaling pathway mcc04620   Toll-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     574217 (CCL4L1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     574217 (CCL4L1)    04061 Viral protein interaction with cytokine and cytokine receptor     574217 (CCL4L1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     574217 (CCL4L1)    04623 Cytosolic DNA-sensing pathway     574217 (CCL4L1)    04062 Chemokine signaling pathway     574217 (CCL4L1)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     574217 (CCL4L1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574217 (CCL4L1) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    574217 (CCL4L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  574217 NCBI-ProteinID:  NP_001028045 Ensembl:  ENSMMUG00000020102 UniProt:  Q8HYQ2 A0A1D5Q1B9 LinkDB All DBs Position 16:complement(26406769..26408762) Genome browser AA seq 92 aa AA seqDB search MKLRVTVLSLLALAAAFCSPALSAPMGSDPPTSCCFSYTVRKLPRNFVVDYYETSSLCSQ PAVVFQTKRGKQVCADPSETWVQEYVYDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctgcgcgtgactgtcctgtctctcctcgcgctagcagctgccttctgctctcca gcactctcagcaccaatgggctcagaccctcccacctcctgctgcttttcttacaccgtg aggaagcttcctcgcaactttgtggtagattactacgagaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaagagggaagcaagtctgcgctgaccccagtgagacc tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system