Macaca mulatta (rhesus monkey): 574325 Help Entry 574325            CDS       T01028                                  Symbol IL13 Name (RefSeq) interleukin-13 precursor   KO K05435   interleukin 13 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04630   JAK-STAT signaling pathway mcc04657   IL-17 signaling pathway mcc04658   Th1 and Th2 cell differentiation mcc04664   Fc epsilon RI signaling pathway mcc05200   Pathways in cancer mcc05310   Asthma mcc05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     574325 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     574325 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     574325 (IL13)    04657 IL-17 signaling pathway     574325 (IL13)    04664 Fc epsilon RI signaling pathway     574325 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     574325 (IL13)   09163 Immune disease    05310 Asthma     574325 (IL13)    05321 Inflammatory bowel disease     574325 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574325 (IL13) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interleukins    574325 (IL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  574325 NCBI-ProteinID:  NP_001028101 Ensembl:  ENSMMUG00000003131 UniProt:  Q864V6 LinkDB All DBs Position 6:130097046..130101956 Genome browser AA seq 132 aa AA seqDB search MALLLTTVIALTCLGGFASPSPVPRSTALKELIEELVNITQNQKAPLCNGSMVWSINLTA GVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLV HLKKLFREGRFN NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggcgcttttgttgaccacggtcattgctctcacttgcctcggcggctttgcctcccca agccctgtgcctcgctctacagccctcaaggagctcattgaggagctggtcaacatcacc cagaaccagaaggccccgctctgcaatggcagcatggtgtggagcatcaacctgacagct ggcgtgtactgtgcagccctggaatccctgatcaacgtgtcaggctgcagtgccatcgag aagacccagaggatgctgaacggattctgcccgcacaaggtctcagctgggcagttttcc agcttgcgtgtccgagacaccaaaatcgaggtggcccagtttgtaaaggacctgctcgta catttaaagaaactttttcgcgagggacggttcaactga

DBGET integrated database retrieval system