Macaca mulatta (rhesus monkey): 693635 Help Entry 693635            CDS       T01028                                  Symbol HIST3H2BB Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     693635 (HIST3H2BB)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     693635 (HIST3H2BB)   09163 Immune disease    05322 Systemic lupus erythematosus     693635 (HIST3H2BB)   09165 Substance dependence    05034 Alcoholism     693635 (HIST3H2BB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     693635 (HIST3H2BB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     693635 (HIST3H2BB) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     693635 (HIST3H2BB) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    693635 (HIST3H2BB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  693635 NCBI-ProteinID:  XP_028682459 Ensembl:  ENSMMUG00000042727 LinkDB All DBs Position 1:86028797..86031789 Genome browser AA seq 126 aa AA seqDB search MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagacccctccaaatcggctcctgcgcccaagaagggttctaaaaaggccgtcacc aaggcgcagaagaaggacggcaagaagcgcaaacgcggccgcaaggagagctattctatc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaatgatatcttcgagcgcatcgccagcgaggcctcccgc ctggcgcactacaacaagcgctccaccatcacgtcccgcgaagtgcagacggccgtgcgc ctgctgctgccgggcgagctggccaagcacgctgtgtccgagggcaccaaggctgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system