Macaca mulatta (rhesus monkey): 694631 Help Entry 694631            CDS       T01028                                  Name (RefSeq) interferon alpha-1/13-like   KO K05414   interferon alpha Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04151   PI3K-Akt signaling pathway mcc04217   Necroptosis mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04622   RIG-I-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc04630   JAK-STAT signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04936   Alcoholic liver disease mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05165   Human papillomavirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05320   Autoimmune thyroid disease mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     694631    04151 PI3K-Akt signaling pathway     694631   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     694631  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     694631  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     694631    04621 NOD-like receptor signaling pathway     694631    04622 RIG-I-like receptor signaling pathway     694631    04623 Cytosolic DNA-sensing pathway     694631    04650 Natural killer cell mediated cytotoxicity     694631  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     694631   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     694631    05161 Hepatitis B     694631    05160 Hepatitis C     694631    05171 Coronavirus disease - COVID-19     694631    05164 Influenza A     694631    05162 Measles     694631    05168 Herpes simplex virus 1 infection     694631    05163 Human cytomegalovirus infection     694631    05167 Kaposi sarcoma-associated herpesvirus infection     694631    05169 Epstein-Barr virus infection     694631    05165 Human papillomavirus infection     694631   09171 Infectious disease: bacterial    05152 Tuberculosis     694631   09163 Immune disease    05320 Autoimmune thyroid disease     694631   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     694631   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     694631  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     694631 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interferons    694631 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  694631 NCBI-ProteinID:  XP_001082177 LinkDB All DBs Position 15:complement(62333405..62334773) Genome browser AA seq 239 aa AA seqDB search MESGPGALRKWKSVCSLFKSSARSKAFRKPRAQGSESPISASPEASAISTMALPFALLMA LVVLSCKSSCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCLMDRHDFGFPQQEFDGNQ FQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCAELYQQLNDLEACVMQQERVG ETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVIRAEIMRSFSLSTNLQERLRRKE NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggaaagtggcccaggagcattaagaaagtggaaatcagtatgttccctatttaagtca tcggctcgaagcaaggccttcagaaaacctagagcccaaggttcagagtcacccatctca gcaagcccagaagcatctgcaatatctacgatggcattgccctttgctttactgatggcc ctggtggtgctcagctgcaagtcaagctgctctctgggctgtgatctgcctgagacccac agcctggataacagaaggaccatgatgctcctgaaacaaatgagcagaatctctccttcc tcctgtctgatggacagacatgactttggatttccccagcaggagtttgatggcaaccag ttccagaaggctccagccatctccgtcctccatgagctgatccagcagaccttcaacctc tttaccacaaaagactcatctgctgcttgggatgaggacctcctagacaaattctgcgct gaactctaccagcagctgaatgacttggaagcctgtgtcatgcagcaggagagggtggga gaaactcccctgatgaatgcggactccaccttggctgtgaagaaatacttccgaagaatc actctctatctgacagagaagaaatacagcccttgtgcctgggaggttatcagagcagaa atcatgagatccttctctttatcaacaaacttgcaagaaagattaaggaggaaggaataa

DBGET integrated database retrieval system