Macaca mulatta (rhesus monkey): 695323 Help Entry 695323            CDS       T01028                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     695323  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     695323   09163 Immune disease    05322 Systemic lupus erythematosus     695323   09165 Substance dependence    05034 Alcoholism     695323  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     695323 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     695323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  695323 NCBI-ProteinID:  XP_014991215 Ensembl:  ENSMMUG00000039982 UniProt:  A0A8J8XEY8 F7HAP8 LinkDB All DBs Position 4:143963463..143964225 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcggcaaaggtttgggtaagggaggcgccaagcgccaccgg aaagtgctgcgggataacatccaaggcatcactaagccggccattcggcgccttgctagg cgtggtggggttaaacggatctccggtttgatttacgaggagacccgaggtgttctcaag gtttttctggagaacgtgatccgggacgccgtgacctatacggagcacgccaagcgcaag actgtcactgccatggatgtggtttacgcgctcaagcgccaaggacgtactctatacggt ttcggcggttaa

DBGET integrated database retrieval system