Macaca mulatta (rhesus monkey): 695512 Help Entry 695512            CDS       T01028                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04144   Endocytosis mcc04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     695512 (RAB10)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     695512 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     695512 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     695512 (RAB10)    04031 GTP-binding proteins [BR:mcc04031]     695512 (RAB10) Membrane trafficking [BR:mcc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     695512 (RAB10)  Protein recycling   Rab GTPases and associated proteins     695512 (RAB10) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    695512 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    695512 (RAB10)   Exosomal proteins of colorectal cancer cells    695512 (RAB10)   Exosomal proteins of bladder cancer cells    695512 (RAB10) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     695512 (RAB10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 SRPRB AAA_7 DUF3963 Motif Other DBs NCBI-GeneID:  695512 NCBI-ProteinID:  XP_014967350 Ensembl:  ENSMMUG00000039805 UniProt:  G7N9K6 A0A8J8XA79 LinkDB All DBs Position 13:complement(82825264..82932715) Genome browser AA seq 200 aa AA seqDB search MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN SENVDISSGGGVTGWKSKCC NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggattcgggagtg gggaagacctgcgtcctttttcgtttttcggatgatgccttcaatactacctttatttcc accataggaatagacttcaagatcaaaacagttgaattacaaggaaaaaagatcaagcta cagatatgggatacagcaggccaggagcgatttcacaccatcacaacctcctactacaga ggcgcaatgggtatcatgctagtatatgacatcaccaatggtaaaagttttgaaaacatc agcaaatggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta ggaaacaagtgtgatatggacgacaaaagagttgtacctaaaggaaaaggagaacagatt gcaagggagcatggtattaggttttttgagactagtgcaaaagcaaatataaacatcgaa aaggcgttcctcacgttagctgaagatatccttcgaaagacccctgtaaaagagcccaac agtgaaaatgtagatatcagcagtggaggaggcgtgacaggctggaagagcaaatgctgc tga

DBGET integrated database retrieval system