Macaca mulatta (rhesus monkey): 695663 Help Entry 695663            CDS       T01028                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05202   Transcriptional misregulation in cancer mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     695663  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     695663   09163 Immune disease    05322 Systemic lupus erythematosus     695663   09165 Substance dependence    05034 Alcoholism     695663  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     695663   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     695663 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     695663 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    695663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  695663 NCBI-ProteinID:  XP_014993055 Ensembl:  ENSMMUG00000045382 LinkDB All DBs Position 4:15285165..15285695 Genome browser AA seq 136 aa AA seqDB search MAPTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTHLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacacccacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system