Macaca mulatta (rhesus monkey): 696363 Help Entry 696363            CDS       T01028                                  Symbol CLDN11 Name (RefSeq) claudin-11   KO K06087   claudin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03272   Virion - Hepatitis viruses mcc04382   Cornified envelope formation mcc04514   Cell adhesion molecule (CAM) interaction mcc04530   Tight junction mcc04670   Leukocyte transendothelial migration mcc05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     696363 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     696363 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     696363 (CLDN11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     696363 (CLDN11)   09158 Development and regeneration    04382 Cornified envelope formation     696363 (CLDN11)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     696363 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcc03037]     696363 (CLDN11)    04147 Exosome [BR:mcc04147]     696363 (CLDN11) Cilium and associated proteins [BR:mcc03037]  Other cilia and associated proteins   Stereociliary proteins    696363 (CLDN11) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    696363 (CLDN11)   Exosomal proteins of colorectal cancer cells    696363 (CLDN11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-LITAF-like Motif Other DBs NCBI-GeneID:  696363 NCBI-ProteinID:  NP_001247482 Ensembl:  ENSMMUG00000009274 UniProt:  I0FS42 A0A8J8XX13 LinkDB All DBs Position 2:75339460..75354307 Genome browser AA seq 207 aa AA seqDB search MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG DAQAFGENPFYYSSGSSSPTHAKSAHV NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggtggccacgtgcctgcaggtggtgggcttcgtcacgagcttcgtgggctggatcggc gtcatcgtgaccacctccaccaatgactgggtggtgacctgcggctacaccatccccacc tgccgcaagctggacgagctgggctccaaggggctgtgggccgactgcgtcatggccacg gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggctatgtgcaggcc tgccgtgccctgatgattgctgcctcagtcctgggtctgccagccattttactgctgctg actgttcttccctgcatccggatgggccatgagcccggtgtggctaagtacaggcgggcc cagctggctggtgttttgctcattctgctggctctctgcgccattgttgccaccatctgg ttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtatgca ggctggattggtgctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctgga gatgcccaggcctttggtgaaaaccctttctactactcttcgggctctagctccccgacg catgccaagagtgcccatgtataa

DBGET integrated database retrieval system