Macaca mulatta (rhesus monkey): 696789 Help Entry 696789            CDS       T01028                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04145   Phagocytosis mcc04814   Motor proteins mcc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     696789 (DYNLT3)   09142 Cell motility    04814 Motor proteins     696789 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     696789 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcc03037]     696789 (DYNLT3)    04812 Cytoskeleton proteins [BR:mcc04812]     696789 (DYNLT3) Cilium and associated proteins [BR:mcc03037]  Motile cilia and associated proteins   Dynein arm    696789 (DYNLT3) Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      696789 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  696789 NCBI-ProteinID:  NP_001253456 Ensembl:  ENSMMUG00000013221 UniProt:  F6X6W3 H9EMG2 LinkDB All DBs Position X:complement(37630339..37639070) Genome browser AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgctgaggaagcccacaat attgtcaaagagtgtgtagatggggttttaggtggtgaagattataatcacaacaacatc aaccagtggaccgcaagcatagtggaacaatccttaacacatttggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaagagcgcatatggctttcacaca gccagctcctgcttttgggataccacatctgatggaacctgtaccgtaagatgggagaac cggaccatgaactgtattgtcaatgtttttgccattgctattgttctttaa

DBGET integrated database retrieval system