Macaca mulatta (rhesus monkey): 698239 Help Entry 698239            CDS       T01028                                  Symbol HIST1H2AA Name (RefSeq) histone H2A type 1-A   KO K11251   histone H2A Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03082   ATP-dependent chromatin remodeling mcc04217   Necroptosis mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     698239 (HIST1H2AA)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     698239 (HIST1H2AA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     698239 (HIST1H2AA)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     698239 (HIST1H2AA)   09165 Substance dependence    05034 Alcoholism     698239 (HIST1H2AA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     698239 (HIST1H2AA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     698239 (HIST1H2AA) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     698239 (HIST1H2AA) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    698239 (HIST1H2AA) SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  698239 NCBI-ProteinID:  NP_001180728 Ensembl:  ENSMMUG00000039988 UniProt:  A0A8J8XKQ1 G7MQV3 LinkDB All DBs Position 4:144266167..144266562 Genome browser AA seq 131 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHHHKAQSK NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggaaagcagggaggaaaagcacgcgccaaagctaagtctcgctcctct agagcaggcttgcagtttcctgtaggtcgaattcaccgtctactccgtaagggaaactat gcagagcggataggggcaggcgcaccagtgtatttggcggcggtgttagaatatctgaca gcagaaattcttgaattggctggcaatgcatctcgtgataacaagaaaactcgtattatt ccccgccacctgcagctagccatccgcaatgacgaggaactcaataagctcttaggcggc gtgaccattgcacagggcggggtcctgcccaacattcaagcagtgctgctgcccaagaag actgagagtcaccaccataaagcccaaagcaagtaa

DBGET integrated database retrieval system