Macaca mulatta (rhesus monkey): 698679 Help Entry 698679            CDS       T01028                                  Name (RefSeq) histone H2B type F-M   KO K11252   histone H2B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     698679  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     698679   09163 Immune disease    05322 Systemic lupus erythematosus     698679   09165 Substance dependence    05034 Alcoholism     698679  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     698679   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     698679 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     698679 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    698679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone TFIID_20kDa TAF CENP-S CBFD_NFYB_HMF Pgp3_helical Motif Other DBs NCBI-GeneID:  698679 NCBI-ProteinID:  XP_028697893 LinkDB All DBs Position X:complement(100718821..100720162) Genome browser AA seq 153 aa AA seqDB search MAAASIMAEASSKTTSEEDQSIQEPKEAKSTTAQKKRRGLRGSRRRHTNRHRDSFGDSFA AYFPQVLKQVHQGLSLSPESVSVMDSMVHDILDRIATEAGRLARYAKRVTITSRDIQVAV RLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccgctgcctccatcatggctgaggcttcctctaagacgacctctgaggaagaccag agcatccaagagcccaaagaggccaaatccaccactgcccagaagaagaggcgagggctc cgaggttcccgcaggcgccataccaaccgccacagggacagcttcggggacagctttgcc gcctatttcccccaggtgctgaagcaggttcaccagggcctcagcctttccccggagtcc gtgagtgtcatggattctatggtccatgacatattggaccgcatcgccaccgaggctggt cgcctggcccgctacgccaagcgtgtgaccatcacctcccgggacatccaggtggccgtg cgcctactgctgccggggaagatgggcaagctcgctgaggcccagggcacgaatgccgcc ctcaggacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system