Macaca mulatta (rhesus monkey): 699700 Help Entry 699700            CDS       T01028                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04010   MAPK signaling pathway mcc04014   Ras signaling pathway mcc04024   cAMP signaling pathway mcc04072   Phospholipase D signaling pathway mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc04218   Cellular senescence mcc04371   Apelin signaling pathway mcc04519   Cadherin signaling mcc04625   C-type lectin receptor signaling pathway mcc04810   Regulation of actin cytoskeleton mcc05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     699700 (RRAS2)    04014 Ras signaling pathway     699700 (RRAS2)    04371 Apelin signaling pathway     699700 (RRAS2)    04072 Phospholipase D signaling pathway     699700 (RRAS2)    04024 cAMP signaling pathway     699700 (RRAS2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     699700 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     699700 (RRAS2)    04137 Mitophagy - animal     699700 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     699700 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     699700 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     699700 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     699700 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     699700 (RRAS2)    04031 GTP-binding proteins [BR:mcc04031]     699700 (RRAS2) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    699700 (RRAS2)   Exosomal proteins of bladder cancer cells    699700 (RRAS2) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     699700 (RRAS2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase RHG35-p190PhoGP_pG1 Motif Other DBs NCBI-GeneID:  699700 NCBI-ProteinID:  NP_001247489 Ensembl:  ENSMMUG00000000664 UniProt:  A0A1D5QAR1 LinkDB All DBs Position 14:51265645..51344385 Genome browser AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc ggcgggggtggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta acagattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa cagtatatgaggactggcgagggcttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa gaaggacagcagttagcacggcaacttaaggtaacatacatggaggcatcagcaaaaatt aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat tgtgtcattttctag

DBGET integrated database retrieval system