Macaca mulatta (rhesus monkey): 700034 Help Entry 700034            CDS       T01028                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04066   HIF-1 signaling pathway mcc04120   Ubiquitin mediated proteolysis mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     700034 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     700034 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     700034 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     700034 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     700034 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mcc04121]     700034 (ELOB)    03400 DNA repair and recombination proteins [BR:mcc03400]     700034 (ELOB) Ubiquitin system [BR:mcc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      700034 (ELOB)    Cul5 complex      700034 (ELOB) DNA repair and recombination proteins [BR:mcc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      700034 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  700034 NCBI-ProteinID:  XP_028696631 Ensembl:  ENSMMUG00000045123 LinkDB All DBs Position 20:2850895..2864005 Genome browser AA seq 145 aa AA seqDB search MPGHARAAGNGAERGRAGASRGEAAAAMDVFLMIRRHKTTIFTDAKESSTVFELKRIVEG ILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPF SSPPELPDVMKPQDSGSSANEQAVQ NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgccgggccacgcgcgggctgccgggaacggggcggagcgcggccgcgccggcgcgtcg aggggagaggcagccgccgcgatggacgtgttccttatgatccggcgccacaagaccacc atcttcacggacgccaaggagtccagcacggtgttcgagctgaagcgcatcgtcgagggc atcctcaagcggcctcctgacgagcagcggctgtacaaggatgaccaactcttggatgat ggcaagaccctgggcgagtgtggcttcaccagtcaaacagcacggccacaggccccagcc acagtggggctggccttccgggcagatgacacctttgaggccctgtgcatcgagccgttc tccagcccacctgagctgcccgatgtgatgaagccccaggactcgggaagcagtgccaat gaacaagccgtgcagtga

DBGET integrated database retrieval system