Macaca mulatta (rhesus monkey): 700193 Help Entry 700193            CDS       T01028                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha precursor   KO K04383   interleukin 1 alpha Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04010   MAPK signaling pathway mcc04060   Cytokine-cytokine receptor interaction mcc04217   Necroptosis mcc04218   Cellular senescence mcc04380   Osteoclast differentiation mcc04640   Hematopoietic cell lineage mcc04932   Non-alcoholic fatty liver disease mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc04940   Type I diabetes mellitus mcc05010   Alzheimer disease mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05133   Pertussis mcc05140   Leishmaniasis mcc05152   Tuberculosis mcc05162   Measles mcc05164   Influenza A mcc05321   Inflammatory bowel disease mcc05323   Rheumatoid arthritis mcc05332   Graft-versus-host disease mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     700193 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     700193 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     700193 (IL1A)    04218 Cellular senescence     700193 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     700193 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     700193 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     700193 (IL1A)    05162 Measles     700193 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     700193 (IL1A)    05152 Tuberculosis     700193 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     700193 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     700193 (IL1A)    05321 Inflammatory bowel disease     700193 (IL1A)    05332 Graft-versus-host disease     700193 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     700193 (IL1A)    05020 Prion disease     700193 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     700193 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     700193 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     700193 (IL1A)    04932 Non-alcoholic fatty liver disease     700193 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     700193 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     700193 (IL1A) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interleukins    700193 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  700193 NCBI-ProteinID:  NP_001036222 Ensembl:  ENSMMUG00000019777 UniProt:  P48089 LinkDB All DBs Position 13:complement(15948769..15959827) Genome browser AA seq 271 aa AA seqDB search MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYDVSYGPLHEGCMDQSVSLSISEIS KTSKLTFKQSMVVVSTNGKVLKKRRLSLSQSITDNNLEAIANDSEEEIIKPRSAPFSFLS NMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKV PVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHP NLFIATKHDNWVCLAKGLPSITDFQILENQA NT seq 816 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa gacagttcctccattgaccatctgtctctgaatcagaaatccttctatgatgtaagctat ggcccactccatgaaggctgcatggatcagtctgtgtccctgagtatctctgaaatctct aaaacatccaagctgaccttcaagcagagcatggtggtagtatcaaccaatgggaaggtt ctgaagaagagacggttgagtttaagccagtccatcactgataataacctggaggccatc gccaacgactcagaggaagaaatcatcaagcccaggtcggcaccttttagcttcctaagc aatatgacataccactttataaggatcatcaaacacgaattcatcctgaatgacaccctc aatcaaactataattcgagccaatgatcagcacctcacggctgctgcaatacataatctg gatgaagcagtgaaatttgacatgggtgcttatacgtcatcaaaggatgatactaaagtt cctgtgattctaagaatctcaaaaactcaattgtatgtgagtgcccaagatgaagaccaa ccggtgctgctgaaggagatgcctgagataaacaaaaccatcacaggtagtgagaccaac ttcctcttcttctgggaaactcatggcactaagaactacttcatatcagttgcccatcca aacttgtttattgccacaaagcatgacaattgggtgtgcttggcaaaggggctaccctct atcactgactttcagatactggaaaaccaggcgtag

DBGET integrated database retrieval system