KEGG   Macaca mulatta (rhesus monkey): 701330
Entry
701330            CDS       T01028                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04927  Cortisol synthesis and secretion
mcc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    701330 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    701330 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 701330
NCBI-ProteinID: XP_001096328
Ensembl: ENSMMUG00000010293
LinkDB
Position
3:complement(14192482..14211440)
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVLLLFLILLYM
SWSGSPQMKNSPKHHQTCPWSHSLSLQLCIQKCLPCHREPLGTSRAQAHSVEPGSRTDPD
QLLRQESSSTLPLGVFQTHPTLLWELTLSGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagatgagaagaagctgaaagcccacaaacattccatcgtgatc
gccttctgggtgagcctggctgccttcgtgctgctcctcttcctcatcctgctttacatg
tcctggtcgggctccccgcagatgaagaacagccccaagcaccaccaaacatgcccctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggggacctcacgggctcaggcgcattcagtggagccagggagcagaactgaccctgac
cagctgctacgacaggagagctcctccaccttgccccttggggttttccagacccacccc
actctcctctgggaactgaccctcagtgggggtcccctcgtcagaagcaagcccagcgag
cctcctcctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system