Macaca mulatta (rhesus monkey): 701464 Help Entry 701464            CDS       T01028                                  Symbol HIST1H2BK Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05203   Viral carcinogenesis mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     701464 (HIST1H2BK)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     701464 (HIST1H2BK)   09163 Immune disease    05322 Systemic lupus erythematosus     701464 (HIST1H2BK)   09165 Substance dependence    05034 Alcoholism     701464 (HIST1H2BK)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     701464 (HIST1H2BK)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     701464 (HIST1H2BK) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     701464 (HIST1H2BK) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    701464 (HIST1H2BK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  701464 NCBI-ProteinID:  NP_001247459 Ensembl:  ENSMMUG00000041377 UniProt:  I0FVV7 LinkDB All DBs Position 4:143066937..143075688 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggagccagcgaagtccgctcctgcgcccaagaagggctcgaagaaggcagtgact aaggcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg ggaatcatgaactccttcgtcaacgacatctttgagcgcattgcgggtgaggcttcccgt ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc aagtacaccagcgctaagtaa

DBGET integrated database retrieval system