Macaca mulatta (rhesus monkey): 703451 Help Entry 703451            CDS       T01028                                  Name (RefSeq) platelet factor 4   KO K05407   platelet factor 4 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     703451    04061 Viral protein interaction with cytokine and cytokine receptor     703451  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     703451  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     703451    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     703451 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    703451 Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Chemokines    703451 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CATSPERB_Ig-like Motif Other DBs NCBI-GeneID:  703451 NCBI-ProteinID:  XP_001102788 Ensembl:  ENSMMUG00000042005 LinkDB All DBs Position 5:59800623..59801659 Genome browser AA seq 101 aa AA seqDB search MSSTARFCPSRPVLLFLGLLLLPVVVAFATAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIVKKLLES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagctccacagcccggttctgcccctcacgccccgtgctgctgtttctggggttgctg ctcctgccagttgtggtcgccttcgccacagctgaagctgaagaagatggggacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatgggagg aaaatttgcttggacctgcaagccccactgtacaagaaaatagttaagaaacttttggag agttag

DBGET integrated database retrieval system