Macaca mulatta (rhesus monkey): 703982 Help Entry 703982            CDS       T01028                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04015   Rap1 signaling pathway mcc04810   Regulation of actin cytoskeleton mcc05014   Amyotrophic lateral sclerosis mcc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     703982 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     703982 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     703982 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     703982 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     703982 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcc04812]     703982 (PFN3)    04147 Exosome [BR:mcc04147]     703982 (PFN3) Membrane trafficking [BR:mcc04131]  Others   Actin-binding proteins    Others     703982 (PFN3) Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      703982 (PFN3) Exosome [BR:mcc04147]  Exosomal proteins   Proteins found in most exosomes    703982 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  703982 NCBI-ProteinID:  XP_001086728 Ensembl:  ENSMMUG00000048792 UniProt:  A0A1D5QCM9 LinkDB All DBs Position 6:complement(174890661..174891490) Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRCTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDPRAVCVGHAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgttgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggataacagctgcgtgtgggcttcgcggcccgggggcctgctg gctgccatctcgccgcaggaggtgggcgtgctcacggggcccgaccgttgcaccttcctg caggcgggcctgagcgtgggcggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcacgcaccaagggactggacccgcgcgccgtgtgcgtg ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system