Macaca mulatta (rhesus monkey): 704127 Help Entry 704127            CDS       T01028                                  Symbol HIST1H2AJ Name (RefSeq) histone cluster 1, H2aj   KO K11251   histone H2A Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03082   ATP-dependent chromatin remodeling mcc04217   Necroptosis mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     704127 (HIST1H2AJ)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     704127 (HIST1H2AJ)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     704127 (HIST1H2AJ)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     704127 (HIST1H2AJ)   09165 Substance dependence    05034 Alcoholism     704127 (HIST1H2AJ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     704127 (HIST1H2AJ)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     704127 (HIST1H2AJ) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     704127 (HIST1H2AJ) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    704127 (HIST1H2AJ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  704127 NCBI-ProteinID:  NP_001180966 Ensembl:  ENSMMUG00000046727 UniProt:  F7C6Q8 A0A8J8Y2B6 LinkDB All DBs Position 4:142387709..142388151 Genome browser AA seq 128 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgtggtaagcagggaggcaaagctcgcgccaaggccaagacccgctcttct cgggccgggcttcagtttcccgtgggccgagtgcaccgcctgctccgcaaaggcaactat gccgagcgggtcggggctggggcaccggtgtacctggctgcggtgctggagtacctgacc gccgagatcctggagctggctggcaacgcggcccgcgataacaagaagactcgcatcatc ccgcgtcacctccagctggccatccgcaacgacgaggagctcaacaaactgctgggcaaa gtcaccatcgcacagggtggtgttctgcccaacatccaggccgtgctgctgccaaagaag accgagagccaccacaagactaagtaa

DBGET integrated database retrieval system