Macaca mulatta (rhesus monkey): 704330 Help Entry 704330            CDS       T01028                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03272   Virion - Hepatitis viruses mcc04382   Cornified envelope formation mcc04514   Cell adhesion molecules mcc04530   Tight junction mcc04670   Leukocyte transendothelial migration mcc05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     704330 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     704330 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     704330 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     704330 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     704330 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     704330 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcc03037]     704330 (CLDN1)    04147 Exosome [BR:mcc04147]     704330 (CLDN1) Cilium and associated proteins [BR:mcc03037]  Other cilia and associated proteins   Stereociliary proteins    704330 (CLDN1) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    704330 (CLDN1)   Exosomal proteins of colorectal cancer cells    704330 (CLDN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC Cytochrom_B_C SUR7 DUF4064 DUF2207_C Motif Other DBs NCBI-GeneID:  704330 NCBI-ProteinID:  NP_001180898 Ensembl:  ENSMMUG00000001915 UniProt:  F6TZW7 A0A8J8XPK1 LinkDB All DBs Position 2:7536511..7551873 Genome browser AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV IGGVIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagcttttgggcttcattctcgccttcctgggatggatcggc gccatcgtcagcactgccctgccccagtggaggatttactcctatgccggcgacaacatc gtgaccgcccaggccatgtacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg cagatccagtgcaaagtctttgactccttgctgaatctgagcagcacattgcaagcaacc cgtgccttgatggtggttggcatcctcctgggagtgatagcaatctttgtggccaccgtt ggcatgaagtgtatgaagtgcttggaagacgatgaggtacagaagatgaggatggctgtc attgggggcgtgatatttcttcttgcaggtctggctattttagttgccacagcatggtat ggcaatagaattgttcaagaattctatgaccccatgaccccagtcaatgccaggtacgaa tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc ctactttgctgttcctgtcctcgaaaaacaacttcatacccaacaccacggccctatcca aaacctgcaccttccagtgggaaagactacgtgtga

DBGET integrated database retrieval system