Macaca mulatta (rhesus monkey): 704416 Help Entry 704416            CDS       T01028                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04015   Rap1 signaling pathway mcc04810   Regulation of actin cytoskeleton mcc05014   Amyotrophic lateral sclerosis mcc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     704416 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     704416 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     704416 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     704416 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     704416 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcc04812]     704416 (PFN4)    04147 Exosome [BR:mcc04147]     704416 (PFN4) Membrane trafficking [BR:mcc04131]  Others   Actin-binding proteins    Others     704416 (PFN4) Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      704416 (PFN4) Exosome [BR:mcc04147]  Exosomal proteins   Proteins found in most exosomes    704416 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  704416 NCBI-ProteinID:  XP_001099519 Ensembl:  ENSMMUG00000009405 UniProt:  A0A8J8Y8Z1 F6XA76 LinkDB All DBs Position 13:84866816..84875197 Genome browser AA seq 129 aa AA seqDB search MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYRCVRADEYSLYAKNENAGVVVVKTHLYLLVATYTEGMYPSVCVEATESL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcctgtgtgtagcatcaccaggttttaatgta atgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaaacccga agagaaggattgtatttcaaggaaaaggattacagatgtgtccgggcagatgaatattct ctttatgccaaaaatgagaacgctggtgtggttgtggtgaagacccatctgtatcttctg gtggcaacttacactgagggcatgtatcctagcgtctgtgtggaagccacagagagcctg ggagactacctaagaaaaaaaggaagttga

DBGET integrated database retrieval system