Macaca mulatta (rhesus monkey): 704498 Help Entry 704498            CDS       T01028                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03010   Ribosome mcc04120   Ubiquitin mediated proteolysis mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc05012   Parkinson disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     704498   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     704498  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     704498    04137 Mitophagy - animal     704498  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     704498    05167 Kaposi sarcoma-associated herpesvirus infection     704498   09164 Neurodegenerative disease    05012 Parkinson disease     704498    05022 Pathways of neurodegeneration - multiple diseases     704498  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mcc03011]     704498    04121 Ubiquitin system [BR:mcc04121]     704498 Ribosome [BR:mcc03011]  Ribosomal proteins   Eukaryotes    Large subunit     704498   Archaea     704498 Ubiquitin system [BR:mcc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    704498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Ubiquitin_5 Rad60-SLD_2 DUF3104 OTU1_UBXL Motif Other DBs NCBI-GeneID:  704498 NCBI-ProteinID:  XP_001092853 UniProt:  G7MJZ0 LinkDB All DBs Position 2:complement(20241830..20242807) Genome browser AA seq 145 aa AA seqDB search MQIFVKTLTGKTITLEVKPSDTNEDVKAKIQDKEGIPPDQQHLILAGKQLEDGRTLSDYD IWEESTLHLVLRLRGSIIEPSLRQLFQKRNFDKMICRKCYACLHPHAVNCCKKCDHTNNL HPKKVKALPSSKGSLPGASIKCLFR NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagacccttacgggcaagaccatcactcttgaggtcaagcccagt gacaccaatgaggatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag cagcatctgatacttgccggcaaacagctggaggatggccgaactctctcagactacgac atctgggaagagtccaccctgcacctggtgctgcgcctgcgaggtagcattattgagcct tccctccgccagctcttccagaaacgcaactttgacaagatgatctgccgcaagtgctat gcttgcctgcacccccatgctgtcaactgctgcaagaagtgtgaccacaccaacaacctg caccccaagaaggtcaaggctcttccttcctcgaagggcagcctccctggagcctcaata aagtgtctctttcgttga

DBGET integrated database retrieval system