Macaca mulatta (rhesus monkey): 704701 Help Entry 704701            CDS       T01028                                  Symbol IL1B Name (RefSeq) interleukin-1 beta precursor   KO K04519   interleukin 1 beta Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01523   Antifolate resistance mcc04010   MAPK signaling pathway mcc04060   Cytokine-cytokine receptor interaction mcc04064   NF-kappa B signaling pathway mcc04217   Necroptosis mcc04380   Osteoclast differentiation mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc04625   C-type lectin receptor signaling pathway mcc04640   Hematopoietic cell lineage mcc04657   IL-17 signaling pathway mcc04659   Th17 cell differentiation mcc04668   TNF signaling pathway mcc04750   Inflammatory mediator regulation of TRP channels mcc04932   Non-alcoholic fatty liver disease mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc04936   Alcoholic liver disease mcc04940   Type I diabetes mellitus mcc05010   Alzheimer disease mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05132   Salmonella infection mcc05133   Pertussis mcc05134   Legionellosis mcc05135   Yersinia infection mcc05140   Leishmaniasis mcc05142   Chagas disease mcc05143   African trypanosomiasis mcc05144   Malaria mcc05146   Amoebiasis mcc05152   Tuberculosis mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05168   Herpes simplex virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05321   Inflammatory bowel disease mcc05323   Rheumatoid arthritis mcc05332   Graft-versus-host disease mcc05417   Lipid and atherosclerosis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     704701 (IL1B)    04064 NF-kappa B signaling pathway     704701 (IL1B)    04668 TNF signaling pathway     704701 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     704701 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     704701 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     704701 (IL1B)    04620 Toll-like receptor signaling pathway     704701 (IL1B)    04621 NOD-like receptor signaling pathway     704701 (IL1B)    04623 Cytosolic DNA-sensing pathway     704701 (IL1B)    04625 C-type lectin receptor signaling pathway     704701 (IL1B)    04659 Th17 cell differentiation     704701 (IL1B)    04657 IL-17 signaling pathway     704701 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     704701 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     704701 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     704701 (IL1B)    05164 Influenza A     704701 (IL1B)    05162 Measles     704701 (IL1B)    05168 Herpes simplex virus 1 infection     704701 (IL1B)    05163 Human cytomegalovirus infection     704701 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     704701 (IL1B)    05135 Yersinia infection     704701 (IL1B)    05133 Pertussis     704701 (IL1B)    05134 Legionellosis     704701 (IL1B)    05152 Tuberculosis     704701 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     704701 (IL1B)    05144 Malaria     704701 (IL1B)    05140 Leishmaniasis     704701 (IL1B)    05142 Chagas disease     704701 (IL1B)    05143 African trypanosomiasis     704701 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     704701 (IL1B)    05321 Inflammatory bowel disease     704701 (IL1B)    05332 Graft-versus-host disease     704701 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     704701 (IL1B)    05020 Prion disease     704701 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     704701 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     704701 (IL1B)    05418 Fluid shear stress and atherosclerosis     704701 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     704701 (IL1B)    04936 Alcoholic liver disease     704701 (IL1B)    04932 Non-alcoholic fatty liver disease     704701 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     704701 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     704701 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     704701 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     704701 (IL1B) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interleukins    704701 (IL1B) Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Cytokines    704701 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  704701 NCBI-ProteinID:  NP_001036221 Ensembl:  ENSMMUG00000042751 UniProt:  P48090 LinkDB All DBs Position 13:complement(16005461..16011323) Genome browser AA seq 269 aa AA seqDB search MAEVPELASEMMAYYSGNEDDLFFDVDGPKQMKCSFQDLDLCPLGGGIQLQISHEHYNEG FRQAVSVVVAMEKLRKMLVPCPQIFQDNDLSTLIPFIFEEEPVFLDTRNNDACVHDAPVR SLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKA KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTRGGQDITDFTMQFVSS NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtacctgagctcgccagtgaaatgatggcttactacagcggcaacgaggat gacttgttctttgacgtcgatggccctaaacagatgaagtgctccttccaggatctagac ctctgccctctgggtggtggcatccagctacaaatctcccacgagcactacaacgagggc ttccggcaggccgtgtcagttgttgtagccatggagaagctaaggaagatgctggttccc tgcccacagatcttccaggacaatgacctgagcaccttgattcccttcatctttgaagaa gaacctgtcttcctcgacacacgcaataacgacgcttgtgtgcatgatgcacctgtacga tcactgcactgcacactccgggatgcacagctcaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatctggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggca aagaatctgtacctgtcctgtgtgttgaaagatgataagcccacgctacagctggagagt gtagatcccaaaaactacccaaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaattcgagtctgcccaattccccaactggtacatcagcacc tctcaagcggaaaacatgcccgtcttcctgggagggaccagaggtggccaggatataact gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system