Macaca mulatta (rhesus monkey): 705582 Help Entry 705582            CDS       T01028                                  Symbol CLDN17 Name (RefSeq) claudin-17   KO K06087   claudin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03272   Virion - Hepatitis viruses mcc04382   Cornified envelope formation mcc04514   Cell adhesion molecules mcc04530   Tight junction mcc04670   Leukocyte transendothelial migration mcc05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     705582 (CLDN17)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     705582 (CLDN17)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     705582 (CLDN17)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     705582 (CLDN17)   09158 Development and regeneration    04382 Cornified envelope formation     705582 (CLDN17)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     705582 (CLDN17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcc03037]     705582 (CLDN17)    04147 Exosome [BR:mcc04147]     705582 (CLDN17)    04515 Cell adhesion molecules [BR:mcc04515]     705582 (CLDN17) Cilium and associated proteins [BR:mcc03037]  Other cilia and associated proteins   Stereociliary proteins    705582 (CLDN17) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    705582 (CLDN17)   Exosomal proteins of colorectal cancer cells    705582 (CLDN17) Cell adhesion molecules [BR:mcc04515]  Immunoglobulin superfamily   L1 family    705582 (CLDN17) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7139 DUF4064 Claudin_3 Jiraiya Clc-like DNER_C Motif Other DBs NCBI-GeneID:  705582 NCBI-ProteinID:  XP_001100305 Ensembl:  ENSMMUG00000011320 UniProt:  F6UF88 LinkDB All DBs Position 3:16510418..16511945 Genome browser AA seq 224 aa AA seqDB search MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARA RLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLG TSGVLFILTGIFVLIPVSWTANVIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGG LLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV NT seq 675 nt NT seq  +upstreamnt  +downstreamnt atggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtgggg actcttgccacgacgcttctgcctcagtggagagtatcagcttttgttggcagcaacatt attgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggcc cggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcc cgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgt ggcatgaagcaagtccagtgcacgggctctaatgagagggccaaagcatatcttctggga acttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggaca gccaatgtaatcatcagagatttctacaacccagctgtccacataggtcagaaacgagag ctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggaggcggt ctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcct ggccactgtgtgccacacacagataagcgaagaaacatgaaaatgcctagtaatacctcc accagttatgtctaa

DBGET integrated database retrieval system