Macaca mulatta (rhesus monkey): 705612 Help Entry 705612            CDS       T01028                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04010   MAPK signaling pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04020   Calcium signaling pathway mcc04151   PI3K-Akt signaling pathway mcc04810   Regulation of actin cytoskeleton mcc05200   Pathways in cancer mcc05207   Chemical carcinogenesis - receptor activation mcc05218   Melanoma mcc05224   Breast cancer mcc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     705612 (FGF16)    04014 Ras signaling pathway     705612 (FGF16)    04015 Rap1 signaling pathway     705612 (FGF16)    04020 Calcium signaling pathway     705612 (FGF16)    04151 PI3K-Akt signaling pathway     705612 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     705612 (FGF16)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     705612 (FGF16)    05207 Chemical carcinogenesis - receptor activation     705612 (FGF16)   09162 Cancer: specific types    05226 Gastric cancer     705612 (FGF16)    05218 Melanoma     705612 (FGF16)    05224 Breast cancer     705612 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     705612 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     705612 (FGF16) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Growth factors (RTK binding)    705612 (FGF16) Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Growth factors/receptors    705612 (FGF16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  705612 NCBI-ProteinID:  NP_001181044 Ensembl:  ENSMMUG00000011744 UniProt:  A0A8J8XH61 F7GWY6 LinkDB All DBs Position X:74141767..74150639 Genome browser AA seq 207 aa AA seqDB search MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH QKFTHFLPRPVDPSKLPSMSRDLFHYR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctcg tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctgaaggggatcctg cggcgccgccagctctactgccgcactggcttccacctggagatcttccccaacggcacg gtgcacggcacccgccacgaccacagccgcttcggtatcctggagtttattagcctggct gtggggctgatcagcatccggggagtggactctggtctgtacctaggaatgaacgagcga ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa gaaaactggtacaacacctatgcctcaaccttgtacaaacattcggactcggagagacag tattacgtagccctgaataaagacggctcaccccgggagggatacaggactaaacgacac cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc agagacctctttcactataggtaa

DBGET integrated database retrieval system