Macaca mulatta (rhesus monkey): 706351 Help Entry 706351            CDS       T01028                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04020   Calcium signaling pathway mcc04022   cGMP-PKG signaling pathway mcc04024   cAMP signaling pathway mcc04070   Phosphatidylinositol signaling system mcc04114   Oocyte meiosis mcc04218   Cellular senescence mcc04261   Adrenergic signaling in cardiomyocytes mcc04270   Vascular smooth muscle contraction mcc04371   Apelin signaling pathway mcc04625   C-type lectin receptor signaling pathway mcc04713   Circadian entrainment mcc04720   Long-term potentiation mcc04722   Neurotrophin signaling pathway mcc04728   Dopaminergic synapse mcc04740   Olfactory transduction mcc04744   Phototransduction mcc04750   Inflammatory mediator regulation of TRP channels mcc04910   Insulin signaling pathway mcc04912   GnRH signaling pathway mcc04915   Estrogen signaling pathway mcc04916   Melanogenesis mcc04921   Oxytocin signaling pathway mcc04922   Glucagon signaling pathway mcc04924   Renin secretion mcc04925   Aldosterone synthesis and secretion mcc04970   Salivary secretion mcc04971   Gastric acid secretion mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05031   Amphetamine addiction mcc05034   Alcoholism mcc05133   Pertussis mcc05152   Tuberculosis mcc05163   Human cytomegalovirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05214   Glioma mcc05417   Lipid and atherosclerosis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     706351    04015 Rap1 signaling pathway     706351    04371 Apelin signaling pathway     706351    04020 Calcium signaling pathway     706351    04070 Phosphatidylinositol signaling system     706351    04024 cAMP signaling pathway     706351    04022 cGMP-PKG signaling pathway     706351  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     706351    04218 Cellular senescence     706351  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     706351   09152 Endocrine system    04910 Insulin signaling pathway     706351    04922 Glucagon signaling pathway     706351    04912 GnRH signaling pathway     706351    04915 Estrogen signaling pathway     706351    04921 Oxytocin signaling pathway     706351    04916 Melanogenesis     706351    04924 Renin secretion     706351    04925 Aldosterone synthesis and secretion     706351   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     706351    04270 Vascular smooth muscle contraction     706351   09154 Digestive system    04970 Salivary secretion     706351    04971 Gastric acid secretion     706351   09156 Nervous system    04728 Dopaminergic synapse     706351    04720 Long-term potentiation     706351    04722 Neurotrophin signaling pathway     706351   09157 Sensory system    04744 Phototransduction     706351    04740 Olfactory transduction     706351    04750 Inflammatory mediator regulation of TRP channels     706351   09159 Environmental adaptation    04713 Circadian entrainment     706351  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     706351   09162 Cancer: specific types    05214 Glioma     706351   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     706351    05163 Human cytomegalovirus infection     706351    05167 Kaposi sarcoma-associated herpesvirus infection     706351   09171 Infectious disease: bacterial    05133 Pertussis     706351    05152 Tuberculosis     706351   09164 Neurodegenerative disease    05010 Alzheimer disease     706351    05012 Parkinson disease     706351    05022 Pathways of neurodegeneration - multiple diseases     706351   09165 Substance dependence    05031 Amphetamine addiction     706351    05034 Alcoholism     706351   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     706351    05418 Fluid shear stress and atherosclerosis     706351  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcc01009]     706351   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     706351    03036 Chromosome and associated proteins [BR:mcc03036]     706351   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     706351 Protein phosphatases and associated proteins [BR:mcc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      706351 Membrane trafficking [BR:mcc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     706351 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      706351 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    706351 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF-hand_11 SPARC_Ca_bdg EF_EFCAB10_C TerB DUF1103 SAPC2_N EF-hand_STIM1 WHD_MCM4 EF-hand_EFHB_C SurA_N_3 Dockerin_1 EFhand_Ca_insen DUF5580_M MecA_N Motif Other DBs NCBI-GeneID:  706351 NCBI-ProteinID:  XP_028708592 LinkDB All DBs Position 8:82112583..82113333 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQTAEFKEAFSLLDKDSDGTITTKELGAVVRSLVQNPTEAELQDVINEVDADG NGTIDFPEFLTKMARKMKDTDSEEEIREAFHVFDKVGNGYISAAELSHVMTNLGEKLTDE EVDEMIREADIDGNGQVNYKEFVQMMKAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgactgaagagcagactgcagaattcaaagaagctttttcactactt gacaaagacagtgatggaactataacaacaaaggaattgggagctgtagtgaggtccctt gtacagaatcccacagaagcagagttacaggacgtgattaatgaagtagatgctgatggt aatggcacaattgacttccctgaatttctgacaaagatggcaagaaaaatgaaagacaca gacagtgaagaagaaatcagagaagcattccatgtgtttgataaggttggcaatggctat attagtgctgcagaactttctcatgtgatgacaaaccttggagagaagttaacagatgaa gaagttgatgaaatgatcagggaagcagatattgatggcaatggtcaagtaaactataaa gagtttgtacaaatgatgaaagcaaagtga

DBGET integrated database retrieval system