Macaca mulatta (rhesus monkey): 706980 Help Entry 706980            CDS       T01028                                  Symbol CAV2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04144   Endocytosis mcc04510   Focal adhesion mcc05020   Prion disease mcc05100   Bacterial invasion of epithelial cells mcc05205   Proteoglycans in cancer mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     706980 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     706980 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     706980 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     706980 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     706980 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     706980 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     706980 (CAV2) Membrane trafficking [BR:mcc04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     706980 (CAV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  706980 NCBI-ProteinID:  NP_001162090 Ensembl:  ENSMMUG00000045554 UniProt:  H9FN78 LinkDB All DBs Position 3:142725100..142734248 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSAQDRDPHRLNSHLKLGFEDVIAEP VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVFVAPLCTSVGRSFSSVSLQLSQD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgggactggagacggagaaggcggacgtgcagctcttcatggacgacgactcctacagc caccacagcggcctcgagtatgccgaccccgagaagttcgcggactcggcccaggaccgg gatccccaccggctcaactcacatctcaagctgggcttcgaggatgtgatcgcagagccg gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttttc gttgctccattgtgtacaagcgtaggacgaagcttctcttctgtcagcctgcaactgagc caggactga

DBGET integrated database retrieval system