Macaca mulatta (rhesus monkey): 707280 Help Entry 707280            CDS       T01028                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc04144   Endocytosis mcc04145   Phagosome mcc04148   Efferocytosis mcc05132   Salmonella infection mcc05146   Amoebiasis mcc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mcc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     707280 (RAB7A)    04145 Phagosome     707280 (RAB7A)    04140 Autophagy - animal     707280 (RAB7A)    04137 Mitophagy - animal     707280 (RAB7A)    04148 Efferocytosis     707280 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     707280 (RAB7A)    05152 Tuberculosis     707280 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     707280 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     707280 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     707280 (RAB7A)    04031 GTP-binding proteins [BR:mcc04031]     707280 (RAB7A) Membrane trafficking [BR:mcc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     707280 (RAB7A) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    707280 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    707280 (RAB7A)   Exosomal proteins of colorectal cancer cells    707280 (RAB7A)   Exosomal proteins of bladder cancer cells    707280 (RAB7A) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     707280 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  707280 NCBI-ProteinID:  XP_014985585 Ensembl:  ENSMMUG00000001798 UniProt:  G7N7V5 A0A8J8Y3V2 LinkDB All DBs Position 2:complement(147686739..147774639) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca ataggagctgactttctgaccaaggaggtgatggtggatgacagactagtcacaatgcag atatgggacacagcaggacaggaacggttccagtctcttggtgtggccttctacagaggt gcagactgctgtgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttccccttt gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg gagctgtacaacgaattccctgaacctatcaaactggacaagaatgaccgggccaaggcc tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system